swissre.comSwiss Re Group | Swiss Re

swissre.com Profile

swissre.com is a domain that was created on 1995-11-10,making it 29 years ago. It has several subdomains, such as cgd.swissre.com corporatesolutions.swissre.com , among others.

Description:The Swiss Re Group is one of the world’s leading providers of reinsurance and insurance. We work to make the world more...

Keywords:best insurance company, best reinsurance...

Discover swissre.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

swissre.com Information

HomePage size: 152.592 KB
Page Load Time: 0.614711 Seconds
Website IP Address: 172.64.145.136

swissre.com Similar Website

Bordier & Cie, Swiss Private Bank
faqs.bordier.com
The Swiss Grid
swissgrid.posterhouse.org
Elna master shop – Swiss design
global.elna.com
swiss smile Dental Beauty – Stay
shop.swiss-smile.beauty
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
La Colline - Exceptional Swiss-Made skincare
ch.lacolline-skincare.com
edel+white Swiss Dental Experts
en.edelwhite.swiss
Swiss Rifles dot com - The message board is dedicated to the arms and equipment carried by Swiss sol
theswissriflesdotcommessageboard.yuku.com
Future Finance | Sygnum Bank - Invest in crypto with a regulated Swiss bank
www.insights.sygnum.com
Switzerland Escorts - Swiss Escort Directory - TopEscortBabes
switzerland.topescortbabes.com
Welcome to the Swiss Bakery Online Shop-n-Ship | Gourmet Swiss Foods, Cheese for Raclette, Sausages
theswissbakeryonline.americommerce.com
Swiss Re 2023 Annual Report | Swiss Re Annual Report
reports.swissre.com
FIDE Grand Swiss 2023 – FIDE Grand Swiss 2023 chess tournament official
grandswiss.fide.com

swissre.com PopUrls

Swiss Re Group | Swiss Re
https://www.swissre.com/
Corporate Insurance & Innovative Risk Solutions | Swiss Re
https://corporatesolutions.swissre.com/
Advance your career, make the world more resilient
https://www.swissre.com/careers.html
Swiss Re - Impact+
https://analytics.swissre.com/
Swiss Re Institute
https://www.swissre.com/institute/
Annual Report 2019 - Home
https://reports.swissre.com/2019/
Shuttle Bus
https://shuttle.swissre.com/
Swiss Re China
https://www.swissre.com/en/china/
Swiss Re Corporate Solutions Careers
https://corporatesolutions.swissre.com/careers.html
About us | Swiss Re
https://www.swissre.com/about-us.html
Investors | Swiss Re
https://www.swissre.com/investors.html
Our leadership | Swiss Re
https://www.swissre.com/about-us/our-leadership.html
Swiss Re 2023 Annual Report | Swiss Re Annual Report
https://reports.swissre.com/
Corporate Solutions | Swiss Re
https://www.swissre.com/corporate-solutions/
Facts & figures | Swiss Re
https://www.swissre.com/about-us/facts-and-figures.html

swissre.com DNS

A swissre.com. 300 IN A 172.64.145.136
AAAA swissre.com. 300 IN AAAA 2606:4700:4400::6812:2a78
MX swissre.com. 266 IN MX 10 swissre-com.mail.protection.outlook.com.
NS swissre.com. 86400 IN NS marge.ns.cloudflare.com.
SOA swissre.com. 1800 IN SOA marge.ns.cloudflare.com. dns.cloudflare.com. 2340747815 10000 2400 604800 1800

swissre.com Httpheader

Date: Tue, 14 May 2024 18:48:16 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
strict-transport-security: max-age=31536000; includeSubDomains; preload
x-xss-protection: 1; mode=block
content-security-policy: "frame-ancestors self *.swissreapps.com", x-frame-options: sameorigin
x-content-type-options: nosniff
x-magnolia-registration: Registered
Cache-Control: no-cache, no-store, must-revalidate, max-age=0
pragma: no-cache
expires: Thu, 01 Jan 1970 00:00:00 GMT
last-modified: Tue, 14 May 2024 16:59:47 GMT
vary: Accept-Encoding
CF-Cache-Status: HIT
Age: 3216
Server: cloudflare
CF-RAY: 883d0fbe3b8d7c79-LAX
alt-svc: h3=":443"; ma=86400

swissre.com Meta Info

content="Swiss Re Group" itemprop="searchData_source"/
content="" itemprop="searchData_contentType"/
content="nonRisk" itemprop="searchData_blogType"/
content="" itemprop="searchData_researchSeries"/
content="" itemprop="searchData_sriTopic"/
content="2024_05_13" itemprop="searchData_date"/
content="/dam/jcr:2ac6319f-af2f-4976-b68b-1cab952e317d/SRN-and-Altbau.jpg" itemprop="searchData_image"/
content="Swiss Re Group" itemprop="searchData_teaserTitle"/
content="/swissre" itemprop="searchData_path"/
content="0b16c81c-f9fa-4c84-af78-4efea8a6887a" itemprop="searchData_id"/
charset="utf-8"
content="IE=edge,chrome=1" http-equiv="X-UA-Compatible"
content="width=device-width,initial-scale=1" name="viewport"/
content="/.resources/swissre-web/webresources/meta/browserconfig.xml" name="msapplication-config"/
content="#627d77" name="msapplication-TileColor"/
content="ccdbd8" name="theme-color"/
content="The Swiss Re Group is one of the world’s leading providers of reinsurance and insurance. We work to make the world more resilient." name="description"/
content="best insurance company, best reinsurance company" name="keywords"/
content="index,follow" name="robots"
content="Swiss Re Group" itemprop="searchData_titleLC"/
content="Swiss Re Group | Swiss Re" property="og:title"
content="The Swiss Re Group is one of the world’s leading providers of reinsurance and insurance. We work to make the world more resilient." property="og:description"
content="https://www.swissre.com/" property="og:url"
content="Swiss Re Group | Swiss Re" name="twitter:title"
content="The Swiss Re Group is one of the world’s leading providers of reinsurance and insurance. We work to make the world more resilient." name="twitter:description"
content="https://www.swissre.com/" property="twitter:site"
content="https://www.swissre.com/dam/jcr:2ac6319f-af2f-4976-b68b-1cab952e317d/SRN-and-Altbau.jpg?14052024185947" property="og:image"/
content="https://www.swissre.com/dam/jcr:2ac6319f-af2f-4976-b68b-1cab952e317d/SRN-and-Altbau.jpg?14052024185947" name="twitter:image"
content="website" property="og:type"/
content="summary_large_image" name="twitter:card"
content="Eal15ogfixWJ1TDCnENsFGm3NVCj2Qqd9PwQvfYN-4Y" name="google-site-verification"
content="Bftm47eqpZBPVzMt7AryyPsLwsABDeIvo8X6opAwb30" name="google-site-verification"
content="mqi2h0bmfrl07bdtikhjj7osp1n71k" name="facebook-domain-verification"

swissre.com Html To Plain Text

Navigation on swissre.com Quick navigation Content Homepage Business Unit Navigation Navigation Search Company Unit Navigation Swiss Re Group (Click to open Universal Navigation) Close Universal Navigation Swiss Re Group Swiss Re Institute Reinsurance Corporate Solutions Swiss Re Foundation Close Universal Navigation , to Homepage Main Navigation Risk Knowledge SustainabilityOur business Investors Media Careers Service Navigation Regional sites Regional sites (click to show list of locations and regional sites) Americas Brazil Country Website Canada Colombia Country Website Mexico Country Website United States of America Asia-Pacific Australia Country Website China Country Website Hong Kong SAR India Japan Country Website Republic of Korea Country Website Malaysia Singapore New Zealand Country Website EuropeMiddle-EastAfrica Denmark France Germany Israel Italy Ivory Coast Luxembourg Slovak Republic Spain Switzerland United Kingdom South Africa Discover all locations Discover all Corporate Solutions locations Close Worldwide Open Search Search Enter search term Type to search entire website submit searchOpen Main Navigation Close Close Navigation back Risk Knowledge Risk Knowledge provides fresh perspectives on key topics, with a focus on enabling growth and innovation in the insurance industry. Discover Living longer, healthier lives Digital transformation in insurance Building a sustainable future Navigating global markets Risk Perspectives blog Mitigating climate risk Swiss Re’s Group Topics Discover Close Navigation back Sustainability Discover Our approach to sustainability Sustainability risk management Sustainability in underwriting Responsible investing Sustainable operations Our people Policies and statements Sustainability news Sustainability Report 2023 Read More about: Sustainability Report 2023 Close Navigation backDiscover Facts & figures Our global presence Our leadership Our approach Corporate governance Compliance Diversity, Equity & Inclusion Swiss Re Centre for Global Dialogue Cultural Engagements Art at Swiss Re Close Navigation back Our business We make the world more resilient. Discover Property & Casualty Reinsurance Life & Health Reinsurance Corporate Solutions Global Clients & Solutions Reinsurance Solutions iptiQ Public Sector Solutions Alternative Capital Partners Asset Management Risk Management Our approach Read More about: Our approach Close Navigation back Investors Discover Financial information Financial calendar Presentations & Conferences Shares Debt Solvency & Ratings Contact us Close Navigation back Media Discover Press Releases Events Electronic Press Kit Contact us Close Navigation back Careers Join us and make a difference to society, helping us predict, prepare and protect against the world’s biggest risks. Discover Login in to My Careers Profile Search Swiss Re Careers Europe, Middle East and Africa Asia Pacific Americas Early Talent Opportunities Working at Swiss Re Data and Technology Careers Graduate Programme Read More about: Graduate Programme Close Navigation Locations and regional sites Americas Asia Pacific Europe, Middle East, & Africa Brazil Country Website Canada Colombia Country Website Mexico Country Website United States of America Australia Country Website China Country Website Hong Kong SAR India Japan Country Website Republic of Korea Country Website Malaysia Singapore New Zealand Country Website Denmark France Germany Israel Italy Ivory Coast Luxembourg Slovak Republic Spain Switzerland United Kingdom South Africa Discover all Corporate Solutions locations Discover all locations Close Navigation Close Navigation Swiss Re Group Highlight Stories Press Release Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant Event 160th Annual General Meeting Publication sigma 1/2024: Natural catastrophes in 2023 Press Release Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant Read press release about Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant Read More about Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant Event 160th Annual General Meeting Swiss Re shareholders approve all proposals at 2024 AGM Discover about 160th Annual General Meeting Read More about 160th Annual General Meeting Publication sigma 1/2024: Natural catastrophes in 2023 Gearing up for today’s and tomorrow’s weather risks Get the publication about sigma 1/2024: Natural catastrophes in 2023 Read More about sigma 1/2024: Natural catastrophes in 2023 Content Teaser Toolbox ​Client tools and services Discover our client tools and services, including information on our many digital tools as well as training courses on a wide range of topics in the insurance industry.​ Explore client tools and services Toolbox SHARE PRICE PERFORMANCE CHF 00.0 − 0.0% 23 Apr 2018 17:30 CET Detailed share performance Explore Investor Relations Share performance Our Group The Swiss Re Group is one of the world’s leading providers of reinsurance, insurance and other forms of insurance-based risk transfer, working to make the world more resilient. The aim of the Swiss Re Group is to enable society to thrive and progress, creating new opportunities and solutions for its clients. Our businesses Property & Casualty Reinsurance We provide you with a broad range of premium products and tailored solutions.​ Discover Property & Casualty risks Life & Health Reinsurance We help unlock your company’s full potential, grow your business and improve your performance. ​ Discover Life & Health Reinsurance Commercial Insurance Our extensive knowledge and expertise allows us to understand, anticipate and help protect against the risks you face.​ Discover Corporate Solutions Global Clients & Solutions We offer a wide range of innovative solutions, risk insights and partnerships to insurers, governments and leading consumer brands across the globe.​ Discover Global Clients & Solutions Latest press releases Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant 22 Apr 2024 Read More about: Swiss Re launches Swiss Re Life Guide Scout, a Generative AI-powered underwriting assistant Swiss Re publishes its 2023 Financial Condition Report 15 Apr 2024 Read More about: Swiss Re publishes its 2023 Financial Condition Report Swiss Re shareholders approve all proposals at 2024 AGM 12 Apr 2024 Read More about: Swiss Re shareholders approve all proposals at 2024 AGM Swiss Re announces Group CEO transition 03 Apr 2024 Read More about: Swiss Re announces Group CEO transition All press releases Press Releases More stories More stories Economic Insights Publication El Niño y La Niña in Latin America: when it rains, it pours 09 May 2024 Read More about: El Niño y La Niña in Latin America: when it rains, it pours Economic Outlook Publication Economic and financial risk insights: US rate cut hopes scaled back as economic strength stays robust 06 May 2024 Read More about: Economic and financial risk insights: US rate cut hopes scaled back as economic strength stays robust Blog Risk insights to tackle the toughest decisions 02 May 2024 Moses Ojeisekhoba Chief Executive Officer Read More about: Risk insights to tackle the toughest decisions Article The evolution of AI in the insurance industry 02 May 2024 Read More about: The evolution of AI in the insurance industry Show previous slide Show next slide Our vision We make the world more resilient Learn more Swiss Re’s 2023 Annual Report Discover about Swiss Re’s 2023 Annual Report Downloads Swiss Re Business Report 2023 Swiss Re Business Report 2023 Swiss Re Financial Report 2023 Swiss Re Financial Report 2023 Swiss Re Sustainability Report 2023 Swiss Re Sustainability Report 2023 Footer Share Price CHF 00.0 − 0.0% CET Newsletters Subscribe about Subscribe to our newsletters Contact us Contact about Contact us About Privacy Terms of Use About Cookies...

swissre.com Whois

Domain Name: SWISSRE.COM Registry Domain ID: 1013602_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.corporatedomains.com Registrar URL: http://cscdbs.com Updated Date: 2023-11-06T06:29:54Z Creation Date: 1995-11-10T05:00:00Z Registry Expiry Date: 2024-11-09T05:00:00Z Registrar: CSC Corporate Domains, Inc. Registrar IANA ID: 299 Registrar Abuse Contact Email: domainabuse@cscglobal.com Registrar Abuse Contact Phone: 8887802723 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: serverDeleteProhibited https://icann.org/epp#serverDeleteProhibited Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited Domain Status: serverUpdateProhibited https://icann.org/epp#serverUpdateProhibited Name Server: MARGE.NS.CLOUDFLARE.COM Name Server: NASH.NS.CLOUDFLARE.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T20:55:57Z <<<